Protein Info for H281DRAFT_00268 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 783 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details PF02743: dCache_1" amino acids 98 to 281 (184 residues), 66 bits, see alignment E=5.4e-22 PF00990: GGDEF" amino acids 336 to 490 (155 residues), 135 bits, see alignment E=3.2e-43 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 337 to 493 (157 residues), 120.3 bits, see alignment E=3.4e-39 PF00563: EAL" amino acids 511 to 746 (236 residues), 238.3 bits, see alignment E=1.2e-74

Best Hits

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_0993)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8U5 at UniProt or InterPro

Protein Sequence (783 amino acids)

>H281DRAFT_00268 diguanylate cyclase/phosphodiesterase (Paraburkholderia bryophila 376MFSha3.1)
MSKTRFSDQREAKSRRDPAASRRRALFAIPALGVLVLVLLWTVIFARLSVEKEATYREAM
ASAAILSAALEQHTIKAIHQVDQITRFVKYEFEKTPGRFDLASTVEKGVVQSETLVQVSL
IDERGQLIANTAELNPKRIDLSDREHFKVHEHENDDQLYISKPVLGRVSGHWTLQMTRRL
NHPDGTFAGVVVVSEDPSYFTSDFYNNAAIGREGVIAVISDNGRVLARRTGSAVNANGSF
SASGSYPTSEHVSGTYVDSIDNVTRIVSYRHIDGYPLGVLVGLSQAEEFADYNHTRNVYL
LMAGFISLAMLSFFAVATGLIGKLLGREREMTHLVEYDLLTGLRNRYATLRTLRHEVAQP
ANLGRLAILFIDLDNFKTVNDTLGHNAGDIVLQMTASRLSTAVADDGTLSRIGGDEFVVV
IKGEDVEKRAVALAEAAAEAFAKPFEVRGSSFVLHASIGIALYSVANESEIDLLKKADLA
MYSAKDAGKNCYQFYSPQLSHRADHLMKWEQQLRVALAEGQLFLAYQPKIDLTRRCITGF
EALVRWNHPQHGLIPANEFIPVAESTGLIVPIGDFVIETACRQLAVWQQQGYDTLSLAVN
ISAVQFWRGDLYETVSHAIEESGISARRLELEITETAMMEYPELVSEKIFALKRLGVRIA
LDDFGTGYSSLSYLNRFSVDTLKVDRSFVQAIPGDRSVCVMVTAIVNLARSLGLTVVVEG
TETEEQIAWLAALGHIEAQGFLFSRPVPVDAIPALLERFGVCGMTGRHPVQETNTSASTS
TNG