Protein Info for H281DRAFT_00247 in Paraburkholderia bryophila 376MFSha3.1
Annotation: T/G mismatch-specific endonuclease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to VSR_ECOLI: Very short patch repair protein (vsr) from Escherichia coli (strain K12)
KEGG orthology group: K07458, DNA mismatch endonuclease, patch repair protein [EC: 3.1.-.-] (inferred from 94% identity to bug:BC1001_0890)Predicted SEED Role
"Very-short-patch mismatch repair endonuclease (G-T specific)" in subsystem DNA repair, bacterial
Isozymes
Compare fitness of predicted isozymes for: 3.1.-.-
Use Curated BLAST to search for 3.1.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MB81 at UniProt or InterPro
Protein Sequence (148 amino acids)
>H281DRAFT_00247 T/G mismatch-specific endonuclease (Paraburkholderia bryophila 376MFSha3.1) MVDIVDSATRSRMMSGIRGRNTKPEVLIRSLLHRQGFRFRLDARDLPGRPDIVLPRYRAV VLVHGCFWHGHDCHLFKWPQTRPEFWREKIGRNRSNDDKVRAALLAGGWRVAVVWECALR GANRDIEGVLTRLVEWLKSDAPSFEERA