Protein Info for H281DRAFT_00224 in Paraburkholderia bryophila 376MFSha3.1

Annotation: amino acid ABC transporter substrate-binding protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 3 to 250 (248 residues), 293.6 bits, see alignment E=6.2e-92 PF00497: SBP_bac_3" amino acids 25 to 251 (227 residues), 206.7 bits, see alignment E=1.7e-65

Best Hits

Swiss-Prot: 60% identical to ARGT_SALTY: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10014, histidine transport system substrate-binding protein (inferred from 97% identity to bgf:BC1003_0936)

Predicted SEED Role

"Histidine ABC transporter, histidine-binding periplasmic protein precursor HisJ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAK9 at UniProt or InterPro

Protein Sequence (258 amino acids)

>H281DRAFT_00224 amino acid ABC transporter substrate-binding protein, PAAT family (Paraburkholderia bryophila 376MFSha3.1)
MKKLALCVALAVMATGAMAKEWKTVRIGVDASYPPFESKAASGQVVGFDVDLTKALCARM
NVKCVWVEQDFDGIIPALKGKKFDAIVSSLTVTDKRREQIDFSDKLFDAPARMIAKAGSP
LLPTAESLKGKRIGVEQGTTQEAYAKAYWEPKGVTVVPYQNQDQVYADLTSGRLDAALQD
EIQADAGFLKTPRGKGFAWAGPEVKDPKTIGEGTAIGLRKEDADLRTMFNRALAQVHQDG
TFTKLEKQYFDFDIYPGH