Protein Info for H281DRAFT_00216 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF01541: GIY-YIG" amino acids 3 to 69 (67 residues), 48.3 bits, see alignment E=5.1e-17

Best Hits

Swiss-Prot: 52% identical to Y4156_CUPNH: UPF0213 protein H16_B0156 (H16_B0156) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K07461, putative endonuclease (inferred from 80% identity to bpy:Bphyt_1115)

Predicted SEED Role

"Ribonuclease E (EC 3.1.26.12)" in subsystem RNA processing and degradation, bacterial or Ribosome biogenesis bacterial (EC 3.1.26.12)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.12

Use Curated BLAST to search for 3.1.26.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>H281DRAFT_00216 putative endonuclease (Paraburkholderia bryophila 376MFSha3.1)
MAWFLYLLECSDGSVYTGIATDVQARFDKHLSGAGARYTRSRKPVRVLASFELADRSSAS
RAEYWVKRLAPSEKRVLAAGGRTLESVVPVTEPDSTNAEEATEENGAA