Protein Info for H281DRAFT_00186 in Paraburkholderia bryophila 376MFSha3.1

Annotation: septum site-determining protein MinD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR01968: septum site-determining protein MinD" amino acids 2 to 269 (268 residues), 346.3 bits, see alignment E=5.1e-108 PF10609: ParA" amino acids 2 to 244 (243 residues), 59 bits, see alignment E=1.7e-19 PF13614: AAA_31" amino acids 3 to 157 (155 residues), 64.9 bits, see alignment E=3.3e-21 PF09140: MipZ" amino acids 4 to 143 (140 residues), 33.5 bits, see alignment E=1e-11 PF01656: CbiA" amino acids 5 to 226 (222 residues), 69.5 bits, see alignment E=9.3e-23 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 28.1 bits, see alignment 4.2e-10

Best Hits

Swiss-Prot: 71% identical to MIND_ECOLI: Septum site-determining protein MinD (minD) from Escherichia coli (strain K12)

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 99% identity to bph:Bphy_0656)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9A4 at UniProt or InterPro

Protein Sequence (271 amino acids)

>H281DRAFT_00186 septum site-determining protein MinD (Paraburkholderia bryophila 376MFSha3.1)
MAKIIVVTSGKGGVGKTTTSASFASALALRGSKTAVIDFDVGLRNLDLIMGCERRVVYDL
INVIQGEANLNQALIKDKKCENLFILPASQTRDKDALTMEGVEKVINDLIAMDFQYIVCD
SPAGIESGALLAMHFADEALIVTNPEVSSVRDSDRILGILSSKTKRAIEGKEPIKEHLLI
TRYNPKRVSEGEMLSLTDIQEILRIDLIGVIPESEAVLHASNQGLPAVHLDGTDVAEAYK
DVVSRFLGEQKSLRFTDYQKPGLLQRLFGTK