Protein Info for H281DRAFT_00171 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Uncharacterized membrane protein YeiH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 12 to 82 (71 residues), 71.8 bits, see alignment E=1.8e-24 amino acids 100 to 173 (74 residues), 87.1 bits, see alignment E=3e-29

Best Hits

KEGG orthology group: None (inferred from 95% identity to bgf:BC1003_0893)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFA4 at UniProt or InterPro

Protein Sequence (207 amino acids)

>H281DRAFT_00171 Uncharacterized membrane protein YeiH (Paraburkholderia bryophila 376MFSha3.1)
VIHPRLTLALTFMEALAIFAYAISGFIEAKTRRLDAVGTFLVAIATAFGGGTLRDVLLER
RPFYWVEHQEYLIAIFAMSLFAPTLLKATSRLLSERVLLVADAIGLGLFSIAGTSIAHDA
QMPWFTSVLMGVATGVFGGVIRDVLCNEVPLILRDSRPYATCAFVGCWLYVLLDYVNFDT
VYSVLIATAFILLSRLATFRFNVRLPH