Protein Info for H281DRAFT_00158 in Paraburkholderia bryophila 376MFSha3.1

Annotation: superoxide dismutase, Cu-Zn family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF00080: Sod_Cu" amino acids 50 to 175 (126 residues), 92.1 bits, see alignment E=2.1e-30

Best Hits

KEGG orthology group: K04565, Cu/Zn superoxide dismutase [EC: 1.15.1.1] (inferred from 96% identity to bgf:BC1003_0879)

Predicted SEED Role

"Superoxide dismutase [Cu-Zn] (EC 1.15.1.1)" (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAZ4 at UniProt or InterPro

Protein Sequence (177 amino acids)

>H281DRAFT_00158 superoxide dismutase, Cu-Zn family (Paraburkholderia bryophila 376MFSha3.1)
MGKRIDWQAVHAFIVLTASSMLLCGCSAFLRPQEKRADAQLLPTVGNQARGLVTFIERSD
GVQVTYNLAGLPPNSDHALQVHERGDCNATDGSSAGQVFSPAAERLKAGARVEGDLGNIH
ADANGVATGFIVAPDVSLDGIRSVLQRAVLLHHDATDPYAYPQHGAGPALACGLIRQ