Protein Info for H281DRAFT_00156 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Outer membrane protein OmpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 28 to 70 (43 residues), 35 bits, see alignment 1.4e-12 PF13488: Gly-zipper_Omp" amino acids 32 to 72 (41 residues), 27.6 bits, see alignment 3.2e-10 PF00691: OmpA" amino acids 107 to 202 (96 residues), 82.7 bits, see alignment E=3.1e-27

Best Hits

Swiss-Prot: 41% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to bgf:BC1003_0877)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9Y7 at UniProt or InterPro

Protein Sequence (217 amino acids)

>H281DRAFT_00156 Outer membrane protein OmpA (Paraburkholderia bryophila 376MFSha3.1)
MNAKITTRLAILAVSGSLLAGCASQQGTNTAVGTGVGAGTGAALGAIFGGGKGAAIGAGV
GAAVGGITGYNWQSIHNKLSGATKGTGTQITEQPDGSLKLNIPSSVTFDTNSYAIKPSFA
PVLDQLTQTLQQNPEVIAQVVGHTDSTGQPAYNQTLSVNRAQSVTGYLAQRGVAPQRLSA
QGMGQNQPIADNNTEAGRAANRRVEIYLRATAQHTTQ