Protein Info for H281DRAFT_00146 in Paraburkholderia bryophila 376MFSha3.1

Annotation: adenosylcobyric acid synthase (glutamine-hydrolysing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF13500: AAA_26" amino acids 17 to 244 (228 residues), 68.5 bits, see alignment E=1.1e-22 PF01656: CbiA" amino acids 18 to 245 (228 residues), 80.9 bits, see alignment E=1.2e-26 TIGR00313: cobyric acid synthase CobQ" amino acids 18 to 498 (481 residues), 451.6 bits, see alignment E=1.7e-139 PF07685: GATase_3" amino acids 268 to 455 (188 residues), 195.2 bits, see alignment E=1.4e-61

Best Hits

Swiss-Prot: 93% identical to COBQ_PARPJ: Cobyric acid synthase (cobQ) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 93% identity to bxe:Bxe_A3492)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MFT8 at UniProt or InterPro

Protein Sequence (504 amino acids)

>H281DRAFT_00146 adenosylcobyric acid synthase (glutamine-hydrolysing) (Paraburkholderia bryophila 376MFSha3.1)
VTIHSISHDAVPVPRGTLMIQGTTSDAGKSTLVAGLCRLARRAGVRVAPFKPQNMALNSA
VTVDGGEIGRAQALQAVAAGIAAHTDLNPVLLKPTSDRGAQVIIHGKARMNLDARAYHEY
KPVAFEAVLASYARLQAAYDTIFVEGAGSPAEINLRERDIANMGFAEAVDCPVVLVADID
RGGVFAHLTGTLACLSASEQARVRGFIINRFRGDIGLLKPGLAWLEAKTGKPVLGVVPYL
HGLTLDAEDMLPPELRAAQRGDAARTLRVVVPVLPHISNHTDFDALRAHPQVDFHYVRSG
TPPPPADLIILPGSKNVRGDLAFLRAQGWDAVLQRHLRYGGRVIGICGGMQMLGREVADP
HGVEGAPGTSAGLGWLDYSTVLTRDKTLKNVTGRLALPGSPEVGGYEIHMGETQGPALES
PALRLGLPGEARPDGAISADGQILATYVHGLFDTPAACAALLAWAGLSDADAIDYPALRE
ASLDRLADTLAEHLDLASLMAAVA