Protein Info for H281DRAFT_00142 in Paraburkholderia bryophila 376MFSha3.1

Annotation: iron complex transport system substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 46 to 274 (229 residues), 99.7 bits, see alignment E=9.3e-33

Best Hits

Swiss-Prot: 39% identical to BTUF_PHOPR: Vitamin B12-binding protein (btuF) from Photobacterium profundum (strain SS9)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 86% identity to bug:BC1001_0761)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>H281DRAFT_00142 iron complex transport system substrate-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MNLSARSLRPALAVMLLAIALRAQAGIAVTDDTGAVLTLPAPAQRVISLAPHVTELLYAA
GGGAKTVGAVSYSDYPPQAQQLPRVGDNKSLDLERIVALKPDLIVVWRHGNAQRQLDRLR
ELHIPLFFSEPHHLDDVAVSLTKLGELLGTSPTADAAAAAYRRDIARLRAQYADRPAVSV
FYQVWDQPLMTLNGEHMVSDVIELCGGRNVFAKLQPLVPTVSTEAVLAANPQAIVTAAPG
ATKPDTALPQLGAWRAWPRLSAVANNNLFSIDGDLINRPAPRIALGAKQMCEDLDLARSR
VRQNAQ