Protein Info for H281DRAFT_00139 in Paraburkholderia bryophila 376MFSha3.1

Annotation: nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 67% identical to COBT_CUPNH: Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (cobT) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00768, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC: 2.4.2.21] (inferred from 88% identity to bxe:Bxe_A3499)

Predicted SEED Role

"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (30/36 steps found)
superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (3/3 steps found)
benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>H281DRAFT_00139 nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MTSSPRLSGLPQVEPLEQTLGSELQHVIDTKTKPPGSLGRLETLARQMGLIQRTTHPAVQ
RPALIVFAGDHGIAAEGVSPYPQAVTAQMVANFLAGGAAVNALSRVAGIELEVVNAGIAT
PLPHTDGLVDIPVGAGTRNFAHEPAMTHEQALSAMQAGAARVRHHAALGSNVIGFGEMGI
ANTSAAACLMSRICGVPIDECVGRGTGLDDAGLAKKRRVLAAALAHHDTSTAPLDVLATF
GGFEIAMMAGAYLAAAQARMTILVDGFIASSALLIADAIAPDVREYCVFAHASNEAGHRR
MLDYFGAQPLLSLDMRLGEGTGAALAVPLLRAACAFINEMASFESAGVANREA