Protein Info for H281DRAFT_00117 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sulfate adenylyltransferase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 57% identical to MMCV_STRLA: Sulfate adenylyltransferase subunit 2 (mmcV) from Streptomyces lavendulae

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 98% identity to bxe:Bxe_A3661)

MetaCyc: 69% identical to sulfate adenylyltransferase small subunit (Allochromatium vinosum)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
assimilatory sulfate reduction I (4/4 steps found)
assimilatory sulfate reduction III (3/3 steps found)
sulfate activation for sulfonation (2/2 steps found)
assimilatory sulfate reduction IV (3/4 steps found)
assimilatory sulfate reduction II (2/3 steps found)
sulfite oxidation III (2/3 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (3/6 steps found)
dissimilatory sulfate reduction I (to hydrogen sufide)) (2/5 steps found)
selenate reduction (2/5 steps found)
superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (2/6 steps found)
superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)
superpathway of seleno-compound metabolism (5/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF99 at UniProt or InterPro

Protein Sequence (320 amino acids)

>H281DRAFT_00117 sulfate adenylyltransferase subunit 2 (Paraburkholderia bryophila 376MFSha3.1)
MSTTLDSTVNAPLANTANRMDHLDWLEAESIHILRELVAECSKPALLFSGGKDSVVVLAL
ALKAFGIGANRKTVLPFPLVHIDTGHNYDEVIDFRDRRAKEIGAELVVGHVEDSIKRGTV
RLRRETDSRNAAQAVTLLETIEQHGYTALIGGARRDEEKARAKERIFSFRDEFGQWDPKA
QRPELWSLYNARLHNGEHLRVFPISNWTELDVWQYIAREKLELPSIYYAHQREIVRRNGL
LVPVTPLTPMREGEVSETAQVRFRTVGDISCTCPVESDADDLEKIIAETAVTEITERGAT
RMDDQVSEAAMEQRKKQGYF