Protein Info for H281DRAFT_00089 in Paraburkholderia bryophila 376MFSha3.1
Annotation: urease accessory protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to URED_PARXL: Urease accessory protein UreD (ureD) from Paraburkholderia xenovorans (strain LB400)
KEGG orthology group: K03190, urease accessory protein (inferred from 86% identity to bug:BC1001_0703)Predicted SEED Role
"Urease accessory protein UreD" in subsystem Urea decomposition
MetaCyc Pathways
- urea degradation II (1/1 steps found)
- superpathway of allantoin degradation in plants (4/8 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (330 amino acids)
>H281DRAFT_00089 urease accessory protein (Paraburkholderia bryophila 376MFSha3.1) MLGASRAGSARSWACGFPSCTFLYQYVDRTFIRMSLHENHATLATVQPEAKAEPHAHWRA RLELGFVRHGERSVLQHRLHDGPLRVQRPLYPEGQAVCHAVIVHPPGGIAGGDQLDIEVN VGAHAHAVITTPGATKWYKSNGRSARQHIAVRVDEHAKLDWLPQNNIVFDHAKADLDFSL TLDEGATAIGWDATQLGRQAAGERWSDGSLRAVSRIARARGELLWLERASLVAGDPLRDA AQGLGGFPAYGTLWAVGAACDDALAEALTAQLPFDDSVRAAASCVTSGVLLVRAVSRSME TLQRALTQCWLQLRPVVHGVEAVPLRIWTT