Protein Info for H281DRAFT_00079 in Paraburkholderia bryophila 376MFSha3.1

Annotation: heptosyltransferase-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR02193: lipopolysaccharide heptosyltransferase I" amino acids 1 to 315 (315 residues), 379.8 bits, see alignment E=5.4e-118 PF01075: Glyco_transf_9" amino acids 67 to 308 (242 residues), 177.4 bits, see alignment E=1.7e-56

Best Hits

KEGG orthology group: K02841, heptosyltransferase I [EC: 2.4.-.-] (inferred from 96% identity to bpy:Bphyt_0921)

Predicted SEED Role

"Lipopolysaccharide heptosyltransferase I (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-, 2.4.1.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAS8 at UniProt or InterPro

Protein Sequence (320 amino acids)

>H281DRAFT_00079 heptosyltransferase-1 (Paraburkholderia bryophila 376MFSha3.1)
LGDVVHNMPVIADIRRRHPEAQIDWLVEESFVGLVELVTGVRRAIPVSLRRWRKRILSIG
NWREISAFRRALAAENYDLVIDCQGLIKTAWVAKMARGPLVGLANRTDGAGFEWPVRFFY
DKRVPIEPRTHVVERTRQLVAAALNDPKPQPTDEIDFGIDTRRAALALSAANLNLPVPYV
VFVHATSRADKQWPDTAWIELGQSLVRRGASIVLPWGSEAERETSERLAKEFGAAAIVPP
RLSLPAVVGLIEGAAATVGVDTGLVHIAAALKRPTVELYNFATAWRTGGYWSPNVVNLGT
AGQPPTLQQVKSALAGFGLL