Protein Info for Ga0059261_4234 in Sphingomonas koreensis DSMZ 15582

Annotation: Multidrug resistance efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 41 to 88 (48 residues), 40.9 bits, see alignment 2.1e-14 PF13437: HlyD_3" amino acids 43 to 126 (84 residues), 23.3 bits, see alignment E=1.4e-08 amino acids 206 to 282 (77 residues), 49.6 bits, see alignment E=9e-17

Best Hits

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 52% identity to nar:Saro_1035)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WIW9 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Ga0059261_4234 Multidrug resistance efflux pump (Sphingomonas koreensis DSMZ 15582)
MKRILPLAAIGIAVLAALIWWAFGRDEGPEPWLGYVEGEAIEVAAPVSGQLAALNVQRGG
QVTAGQPLFALNAATTEAELKRLRAQLASAQAQRDDLAKARQRPAELDIARAQQAAARAE
VTRTAREYQRIATLAQRGFATKSQLDAARAAADGARASLSQAQASEASGKLAGRVDQIAA
ADAQIAAAQAAIAVQSRRGEEIAPLAPAAGLVEQTYFNPGEWVPANTPVVRLLPPGRVKI
RFYAPQAAVAGLKPGSKVTVTCDGCGGPVAATVRYVAAQAEFTPPVIYSERARAKLVFLV
EAYPDSGIERFRPGLPVEVQPQ