Protein Info for Ga0059261_4164 in Sphingomonas koreensis DSMZ 15582

Annotation: tRNA (guanine-N1)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 6 to 226 (221 residues), 250.2 bits, see alignment E=7.7e-79 PF01746: tRNA_m1G_MT" amino acids 26 to 219 (194 residues), 158.7 bits, see alignment E=7.5e-51

Best Hits

Swiss-Prot: 82% identical to TRMD_SPHWW: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 82% identity to swi:Swit_2662)

MetaCyc: 44% identical to tRNA m1G37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12458 [EC: 2.1.1.228]

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.228 or 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WIQ5 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Ga0059261_4164 tRNA (guanine-N1)-methyltransferase (Sphingomonas koreensis DSMZ 15582)
MSFAATVLTLYPEMFPGPLGTSIAGRALADGKWSLDTVQIRDFATDKHRTVDDTPAGGGA
GMVLKADILAAACDHVGYDRPMLAMTPRGAPLTQERVRALAAGPGVSILCGRFEGFDERL
FEACAIEPVSIGDYILSGGEMGALVLLDACIRLLPGVMGAPSSGVEESFESGLLEYPQYT
RPVEWEGRTIPQVLRSGDHAKIAAWRKQQAEIDTRLRRPDLWERHEGARVQSPSGARQKK
DE