Protein Info for Ga0059261_4147 in Sphingomonas koreensis DSMZ 15582

Annotation: phage shock protein A (PspA) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR02977: phage shock protein A" amino acids 1 to 219 (219 residues), 276.9 bits, see alignment E=6.4e-87 PF04012: PspA_IM30" amino acids 2 to 219 (218 residues), 127.5 bits, see alignment E=3e-41

Best Hits

Swiss-Prot: 43% identical to PSPA_SHIFL: Phage shock protein A (pspA) from Shigella flexneri

KEGG orthology group: K03969, phage shock protein A (inferred from 80% identity to sjp:SJA_C1-34120)

Predicted SEED Role

"Phage shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JCL1 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Ga0059261_4147 phage shock protein A (PspA) family protein (Sphingomonas koreensis DSMZ 15582)
MGIFSRTRDIIAANMTDLLDKAEDPAKMIRMIILEMEETLVEVRASAARTIADQKEMRRH
IAKLENLQLSWTEKAELALSKDREDLAKAALVERQKAFDMCDQLQAEIAVLDDALRASEE
DIAKLQTKLRDARARQNAITTRLESANNRVKLREMTHGSKVSEAFSRFDLLERRVDFAEG
RADALALGAPKKTLEEEIAELQSAEKVDAELAALKARLNKEG