Protein Info for Ga0059261_4145 in Sphingomonas koreensis DSMZ 15582

Annotation: phage shock protein C (PspC) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details TIGR02978: phage shock protein C" amino acids 6 to 124 (119 residues), 110.8 bits, see alignment E=1.9e-36 PF04024: PspC" amino acids 7 to 62 (56 residues), 57.1 bits, see alignment E=6.3e-20

Best Hits

KEGG orthology group: None (inferred from 56% identity to sch:Sphch_2040)

Predicted SEED Role

"Phage shock protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WIU6 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Ga0059261_4145 phage shock protein C (PspC) family protein (Sphingomonas koreensis DSMZ 15582)
MSASRTQLYRDKVNGKWLGVCEGLGEYTGVDPLWIRLGFLALLVATFPLMFFVYIGLAMV
TSQKPIGLYQNNEDAKFWQGVRANPRRSTQEVRSKLRDIDRRMADIEMFYTSRNTQLADE
IERLR