Protein Info for Ga0059261_4095 in Sphingomonas koreensis DSMZ 15582

Annotation: O-antigen ligase like membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 213 to 249 (37 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 339 to 365 (27 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details PF04932: Wzy_C" amino acids 220 to 356 (137 residues), 40.1 bits, see alignment E=1.6e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WIM8 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Ga0059261_4095 O-antigen ligase like membrane protein (Sphingomonas koreensis DSMZ 15582)
MSYSDIASSVWVAEDQDRTSYHHAMLRLAAPMLLLAVFLSPYVVWRVVPPYLFTLSDALF
CIAGILLLAGRGIVVRPLQDWSALWLLGLAGLLLGFFIGSVVNGDPLRWIIVAGQYGFAF
ALLPALLLRERRRSLILAVMALIAGVAAMELFGTIVYYATDASHEQARHFGFEFITGAQR
LGAFMADANWNAAMIAMTTPFVLYLARIGQLKLPVAFAILGIFGSGLLLSGSFTGFASTA
VGALAFLLLDWGRRSIGMLIGIVALASAMTATGIALPATFQNRVATALVQGDISQAGTFA
GRMELVREAWNIVGDTTLVGLGVDQYRVVSIDRAPVHNIYLLAWAEGGLLSLFGWLLMML
VPVSVAIRRFATDRAAAALLIAVTLSFLIFSNAAPHMYARSWVVPLILALGIALTRPAGA
NGPVPSS