Protein Info for Ga0059261_4014 in Sphingomonas koreensis DSMZ 15582

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF08534: Redoxin" amino acids 4 to 156 (153 residues), 125.3 bits, see alignment E=1.7e-40 PF00578: AhpC-TSA" amino acids 5 to 115 (111 residues), 40.5 bits, see alignment E=2.4e-14

Best Hits

Swiss-Prot: 52% identical to PRX2B_ARATH: Peroxiredoxin-2B (PRXIIB) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 84% identity to sjp:SJA_C1-16860)

MetaCyc: 52% identical to glutaredoxin-dependent peroxiredoxin (Arabidopsis thaliana col)
RXN-20687 [EC: 1.11.1.25]

Predicted SEED Role

"Peroxiredoxin"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JD00 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Ga0059261_4014 Peroxiredoxin (Sphingomonas koreensis DSMZ 15582)
MTIQVGDRVPSTTFVKPTENGPEQVSSDEFFAGRKVALFSVPGAFTPTCSARHLPGYVEK
AAELKAKGVDEIACTAVNDAFVMGAWGKSADAGDIAMLADGNGEFAKAVGLEMDGSKFGL
GTRGQRFSMLVNDGVVEQLHVEAPGEFKVSSAEYLLDNL