Protein Info for Ga0059261_3953 in Sphingomonas koreensis DSMZ 15582

Annotation: Type II secretory pathway, component PulF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 171 to 194 (24 residues), see Phobius details amino acids 215 to 241 (27 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF00482: T2SSF" amino acids 73 to 195 (123 residues), 97.8 bits, see alignment E=2.3e-32 amino acids 275 to 397 (123 residues), 91.6 bits, see alignment E=1.9e-30

Best Hits

Swiss-Prot: 42% identical to GSPF_AERHY: Type II secretion system protein F (exeF) from Aeromonas hydrophila

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 67% identity to swi:Swit_2583)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WI36 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Ga0059261_3953 Type II secretory pathway, component PulF (Sphingomonas koreensis DSMZ 15582)
MPAFAYRAATSAGAEKKGLIEATSAAAARAMLREQGLLPLAVDAASERRSIGSIKLPGLG
RSGMSARELATATRQIATLVGSDIPVEEALRLAASQSEAQRVSSILLEVRAAILDGRSFA
NALGTHPKTFPEFYRASVAAGESSGKLTQVLEHLAHFVENRQANSQKLQLALLYPGLLAT
VSLGVIVLLLVYVIPDIVKVFVSRGTDLPLLTRTLIAISGFLQAWGLYILIAALIGFVIY
GRWVANPANRLKVHRAFTERWPFRRFSRQHNAARFAGSLATLVSSAVPLVEALHAAAAVT
PNRWVRERALHVAARVREGISLRAAMTEAGVFPLMLTAIVASGEASGQLGPALSRAADEL
DRELDAVTSAMVALVEPLVLLLMGGIVLMMVLAILLPIINLNDLVTL