Protein Info for Ga0059261_3932 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 116 to 134 (19 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details PF01944: SpoIIM" amino acids 120 to 299 (180 residues), 111.1 bits, see alignment E=2.8e-36

Best Hits

KEGG orthology group: None (inferred from 56% identity to sch:Sphch_1893)

Predicted SEED Role

"FIG00791727: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JD41 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Ga0059261_3932 Uncharacterized membrane protein (Sphingomonas koreensis DSMZ 15582)
MSSAATPAFGVRHFRAEREADWQRLEALLDLVEKKSPKRLTNDDLVELPRLYRATLSALS
IARETSLDASMTAYLESLSTRAYFVLYGCRDPLWRQIGGFFTHGWPTAVRGIVGETLLIA
ALFFACALAGYFLVAGDPAWFNALVPAEMAGGRDMNATAQYLRSTLYDAPDQGGLEVFAT
YLFTHNAQISILAFALGFAFAIPTFFLIASNGVLLGAMYAVFVPKGLGFGFTGWLLIHGS
TELSAIILAGAAGLHIGRAVAFPGQRTRVAAAGEAGRRAALVMIGVVIMLLVAGLLEGFA
RQLITDDSARYGIAATMFAFWVAYFALGGRRAHG