Protein Info for Ga0059261_3860 in Sphingomonas koreensis DSMZ 15582

Annotation: Ku protein, prokaryotic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR02772: Ku protein" amino acids 3 to 263 (261 residues), 287.9 bits, see alignment E=3.8e-90 PF02735: Ku" amino acids 14 to 194 (181 residues), 165.2 bits, see alignment E=8.5e-53

Best Hits

Swiss-Prot: 37% identical to KU_BRASO: Non-homologous end joining protein Ku (ku) from Bradyrhizobium sp. (strain ORS 278)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 82% identity to sch:Sphch_3000)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JDF1 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Ga0059261_3860 Ku protein, prokaryotic (Sphingomonas koreensis DSMZ 15582)
MAARAYWQGQIKLALVSIPVEVYPATKSGAAVSFRQIHEPTGKPIRYEKVVSGVGPVDRD
EILKGYELSKGNYVLLEQDEIDAVKIESRKTLDLIQFVDADAIDVLYYEKPYFVVPADDL
AEEAYAVLRDALRQTRKVGLGQLSVRGREQLVSLKPCGRGLVLEVLRYADEVNKAQTYFR
GMPEETADEDMLDLATSIIEKRTAPFKPEEFHDRYVDALHRLIDKKKKAKGKRIIEEVDD
QPGGRSGSNVIDLMAALKKSAGEAARKPAAKKARSPAKAPATTKRASPAKRKRAG