Protein Info for Ga0059261_3859 in Sphingomonas koreensis DSMZ 15582

Annotation: MgtC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 109 to 143 (35 residues), see Phobius details PF02308: MgtC" amino acids 20 to 147 (128 residues), 93.5 bits, see alignment E=6.4e-31

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 48% identity to mno:Mnod_2398)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WHV5 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Ga0059261_3859 MgtC family (Sphingomonas koreensis DSMZ 15582)
MILNPDTPLHLIDGPVLLRLGAATVLGLLLGLDRELRGHPAGLRTHGMICFTSALMTVCA
IALHGQLRGQGSIDPLRVFEASAAFTGIIAAGLIVFSKGEIRNLTTAAHVWLASMIGIAC
GAALWPLVVSATIVAVAMLSLLGFVERRWLNPDGEDKQ