Protein Info for Ga0059261_3834 in Sphingomonas koreensis DSMZ 15582

Annotation: Molecular chaperone (small heat shock protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00011: HSP20" amino acids 56 to 156 (101 residues), 93.8 bits, see alignment E=6.3e-31 PF17886: ArsA_HSP20" amino acids 60 to 138 (79 residues), 30 bits, see alignment E=3e-11

Best Hits

KEGG orthology group: K13993, HSP20 family protein (inferred from 52% identity to sch:Sphch_0895)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WHS1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Ga0059261_3834 Molecular chaperone (small heat shock protein) (Sphingomonas koreensis DSMZ 15582)
MNDITPIARDPSPAPETPFGWLRHEIDRLFEDVGRPARGLTHLAAGFGPVPVVELVEREE
DYRLTAELPGVKEDDVDLSITDGVLTLKGEKHENEERKDGSFMLSERRYGAFERQIRLPS
DADADKIDAKFKKGVLTLTIAKDQRKAQQARKIPVNAG