Protein Info for Ga0059261_3825 in Sphingomonas koreensis DSMZ 15582

Annotation: thiol reductant ABC exporter, CydD subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 21 to 52 (32 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 29 to 548 (520 residues), 466.7 bits, see alignment E=6.2e-144 PF00664: ABC_membrane" amino acids 56 to 268 (213 residues), 57.2 bits, see alignment E=3.2e-19 PF00005: ABC_tran" amino acids 360 to 506 (147 residues), 83.8 bits, see alignment E=2.8e-27 PF13304: AAA_21" amino acids 478 to 536 (59 residues), 29.2 bits, see alignment 1.4e-10

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 57% identity to ccr:CC_0761)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WHX2 at UniProt or InterPro

Protein Sequence (552 amino acids)

>Ga0059261_3825 thiol reductant ABC exporter, CydD subunit (Sphingomonas koreensis DSMZ 15582)
MSTIALQREATRRRRHGLAELVGDASAALSTTLLLCDALTAIGFAAGLAMAVAGLADGGS
MLPGAAIAVAAGGARAVAAMLALRVGARRAREVKLRLRETALGATLRRARGSDSETGALI
QAVVDEVEAIDGHIARFLPARRAAAMAPLLVLGAVAIASPVAAALLAGTLLPFVFGLALA
GGAAASESRRQFKALSRLSGLLADRVRALPVILAFRAEGREADRIGVAAEEVARRTMKVL
RVAFLSTGALEFFAALSVALVAVYAGFNLLGELPFPAPEQLDLGRAFLVLALAPEFYLPM
RRLAAAYHDRQAAESAAERLGALQAAAAPAVAAEPWCAHAPSLRLVDVAICYPDGDAVVR
GLSFHAEPGKIVALVGPSGSGKSSVLHLLLGLAPLGSGTILIDGKPLPPGASLADSSSWA
GQAPLILPGTIAFNIGLAAPAATSSDIARAACEAGMDMMLATRPGGLHGRVDLRGGGLSG
GERRRIGLARAILKPAPILLLDEPTAHLDREAEDDLVRLIARAARGRTTILATHSERLAA
IADQVVELEGIR