Protein Info for Ga0059261_3801 in Sphingomonas koreensis DSMZ 15582

Annotation: Phosphate/sulphate permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details PF01384: PHO4" amino acids 23 to 327 (305 residues), 305.3 bits, see alignment E=2.6e-95

Best Hits

Swiss-Prot: 62% identical to PIT_RHIME: Probable low-affinity inorganic phosphate transporter (pit) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 86% identity to sal:Sala_0717)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WHQ8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Ga0059261_3801 Phosphate/sulphate permeases (Sphingomonas koreensis DSMZ 15582)
MHELAFPLLVGLILVALAFDFLNGLHDAANSIATVVATRLLGPVQAVAFAAFFNFAAYFL
TLAWPELHKVAETIGKGIIDKDLVTPGVVFGALIGAIFWNVVTWIKGIPSSSSHALVGGI
VGAGVAHAGVTGIEWSGLNKTLIAIVLSPLLGMMLAMLIMLVSSWAFARATNRTAEKSFR
ALHLFSSAAYSVSHGLNDAQKTMGIITVLLYSTGYLSGEFHVPHWVAIACYVAIALGTLS
GGWKIIETMGSRITKLSQHQGFSASMGGSIMVFTASLLGIPVSTTHTITGSIIGAGTARR
ASAVRWGVARNVIWAWFITIPASAAVGALFYLLTRLF