Protein Info for Ga0059261_3728 in Sphingomonas koreensis DSMZ 15582

Annotation: ribosomal protein S10, bacterial/organelle

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01049: ribosomal protein uS10
  • amino acids 4 to 100 (97 residues), 144.5 bits, E=5e-47
• PF00338: Ribosomal_S10
  • amino acids 6 to 100 (95 residues), 121.2 bits, E=9.4e-40

Best Hits

Swiss-Prot: 94% identical to RS10_SPHAL: 30S ribosomal protein S10 (rpsJ) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02946, small subunit ribosomal protein S10 (inferred from 96% identity to zmn:Za10_0737)

MetaCyc: 65% identical to 30S ribosomal subunit protein S10 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S10p (S20e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

See A0A1L6JDR0 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Ga0059261_3728 ribosomal protein S10, bacterial/organelle (Sphingomonas koreensis DSMZ 15582)
MDNNIRIRLKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTKIEKFTVNRGPHIDKKS
REQFEVRTYKRMLDIVQPTPQTVDALMKLDLAAGVDVEIKLA