Protein Info for Ga0059261_3726 in Sphingomonas koreensis DSMZ 15582

Annotation: translation elongation factor TU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR00485: translation elongation factor Tu" amino acids 1 to 395 (395 residues), 728.2 bits, see alignment E=2e-223 PF00009: GTP_EFTU" amino acids 10 to 203 (194 residues), 211.9 bits, see alignment E=9.6e-67 TIGR00231: small GTP-binding protein domain" amino acids 14 to 146 (133 residues), 58 bits, see alignment E=1e-19 PF03144: GTP_EFTU_D2" amino acids 227 to 297 (71 residues), 66.5 bits, see alignment E=3.4e-22 PF03143: GTP_EFTU_D3" amino acids 301 to 395 (95 residues), 128.8 bits, see alignment E=1.5e-41

Best Hits

Swiss-Prot: 88% identical to EFTU_SPHAL: Elongation factor Tu (tuf) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02358, elongation factor Tu (inferred from 88% identity to sal:Sala_2820)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JDQ1 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Ga0059261_3726 translation elongation factor TU (Sphingomonas koreensis DSMZ 15582)
MAKAKFERTKPHLNIGTIGHVDHGKTSLTAAITKVLAEEGLSEKVDFENIDKAPEERERG
ITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTKEHI
LLAKQVGVPTMVVFLNKVDQVDDEEILELVEMEIREELSKRDFDGDNIPIIRGSALAALE
SRDDNIGKAQILALMAAVDESIPQPDRPLDKPFMMPIEDVFSISGRGTVVTGRVETGIVK
VGEEVEIVGIHPEVRKTTVTGVEMFRKLLDQGQAGDNIGALIRGVARDEVERGQVLAKPG
SITPHTDFQSEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGTIELPSGTEMVMPGDNV
ALGVKLIAPIAMDVGQRFTIREGGRTVGAGVVSGIDK