Protein Info for Ga0059261_3724 in Sphingomonas koreensis DSMZ 15582

Annotation: ribosomal protein S7, bacterial/organelle

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF00177: Ribosomal_S7" amino acids 1 to 149 (149 residues), 222.3 bits, see alignment E=1.1e-70 TIGR01029: ribosomal protein uS7" amino acids 3 to 156 (154 residues), 226.7 bits, see alignment E=6e-72

Best Hits

Swiss-Prot: 88% identical to RS7_SPHWW: 30S ribosomal protein S7 (rpsG) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 88% identity to swi:Swit_1357)

MetaCyc: 62% identical to 30S ribosomal subunit protein S7 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S7p (S5e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JDT7 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Ga0059261_3724 ribosomal protein S7, bacterial/organelle (Sphingomonas koreensis DSMZ 15582)
MARRRRPEKREILPDPKFGDVVLSKFMNSVMLDGKKAVAEGIVYSALDTVEQRAKKDPLG
VFHDALNNIKPGIEVRSRRVGGATYQVPVEVRPERAQALAIRWLITSARNRSENTMSARL
SGELLDASNNRGNAVKKREDTHRMAEANRAFSHYRW