Protein Info for Ga0059261_3695 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted metal-dependent hydrolase with the TIM-barrel fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07969: Amidohydro_3" amino acids 72 to 546 (475 residues), 321.1 bits, see alignment E=2e-99 PF01979: Amidohydro_1" amino acids 331 to 545 (215 residues), 28.4 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K07047, (no description) (inferred from 64% identity to eli:ELI_01620)

Predicted SEED Role

"FIG00636284: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WHI2 at UniProt or InterPro

Protein Sequence (558 amino acids)

>Ga0059261_3695 Predicted metal-dependent hydrolase with the TIM-barrel fold (Sphingomonas koreensis DSMZ 15582)
VRLPVSLSLAASLLLASPASADALVENVDGMTLDEKGEVVRFTGIVIAPDGKIVKLLKRG
EKRPERPDWKEDLKGRTVIPGMIDGHGHVMGLGFRALALDLSATTSLAQAQEAIRRYALE
NAARPWLTGGGWNQEAWALGRFPTAAELDAATGDKPAWFTRADGHAGWANSAAMKAAGIT
PATKSPAGGRIELIAGKPGGVFVDAAMDLIEKALPKPTPRDRNAAFLKAQDQLLALGVTA
SADMGTSLDDWQTFRRMGDLGALRMRIISYAAGVETALVTAGTGPTPWLYGDKLRMGGIK
LMVDGALGSRGAWLKAPYADAPGVTGLPFLSDAQLLNSISRGAMDHFQIAIHAIGDRGNQ
QVLDAIDEVADTFNGDRRWRIEHAQIVDPADLPRFAKHGIIASMQPVHQTSDRTMAEARL
GQTRLTGAYAWRSMLANNVRLAFGSDYPVESPNPFEGWAAGFTRQDAQGQPFGGWRPEEA
VSREQAWKGFTIDAAYAGFGEKLFGHLAPGMLADFIVLDRDPLLASPTDLRATVVLETWV
GGQRVYRRSDAAKAGEGR