Protein Info for Ga0059261_3620 in Sphingomonas koreensis DSMZ 15582

Annotation: molybdenum cofactor biosynthesis protein A, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 7 to 332 (326 residues), 353.3 bits, see alignment E=6e-110 PF04055: Radical_SAM" amino acids 20 to 180 (161 residues), 120 bits, see alignment E=1.8e-38 PF13353: Fer4_12" amino acids 24 to 127 (104 residues), 29.5 bits, see alignment E=1.3e-10 PF06463: Mob_synth_C" amino acids 187 to 312 (126 residues), 126.2 bits, see alignment E=1.2e-40

Best Hits

Swiss-Prot: 58% identical to MOAA_ERYLH: GTP 3',8-cyclase (moaA) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 69% identity to sjp:SJA_C1-14150)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WH70 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Ga0059261_3620 molybdenum cofactor biosynthesis protein A, bacterial (Sphingomonas koreensis DSMZ 15582)
MATAPALIDRHGRTIRYLRVSVTDRCDLRCRYCMAEKMTFLPRSELLALEEIALIAERFI
ARGVAKIRLTGGEPLVRRDVIDLVRRLGRHVGSGLDELTLTTNGMRLAEYAGPLVQAGIR
RINVSLDSRDPETFRHITRHGDLQQVLDGIAAARTAGLSVKINMVALKGLNEAEIAPMLA
WTGASGMDLTLIETMPLGAIDEDRADRFLPLTEVFDDLSRRFTLSPDPHRSGGPARYWQV
AETGARLGLISPLTGNFCESCNRVRLTTEGKLFTCLGHEDHVDLKTAIREGGLTALDAAI
DEALAAKPARHDFSVARGAGPAVGRYMSVTGG