Protein Info for Ga0059261_3607 in Sphingomonas koreensis DSMZ 15582

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF07715: Plug" amino acids 66 to 166 (101 residues), 78.5 bits, see alignment E=5.3e-26 TIGR01783: TonB-dependent siderophore receptor" amino acids 68 to 778 (711 residues), 323.9 bits, see alignment E=1.2e-100 PF00593: TonB_dep_Rec" amino acids 242 to 749 (508 residues), 188.9 bits, see alignment E=3.2e-59

Best Hits

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WH81 at UniProt or InterPro

Protein Sequence (780 amino acids)

>Ga0059261_3607 TonB-dependent siderophore receptor (Sphingomonas koreensis DSMZ 15582)
MQVARRSGKLFNGLSRSALIVCSLAMPMLAAANEGNEAEDGRSDTVVITGVNTQGIGSGT
KTDTPLMETPQSITVIDGEELTLRNAQSINQALGYVAGVSPNQRGGMVTRYDQLILRGFA
PGVYQDGMRLIAGPYSTPQIDFNRVERIDIVKGPASVLYGNSTPGGLVNLVSKMPEATEF
GRVELQAGNYDTLRAVADINQPLDSQGRLLFRVVGGWQKNDGLTRGTFSERYHVSPMLTF
APTDRTSLTLIATYQRSPSGGGYSGVPAYGSVLTNPLGEFSRDINTGDPAYERYDHKQKA
IAAFFRHEFDDSLSFRSNFRFQNNQLSYRQLYVAGFATTGNGANRNSDFSTIIRGGGGAD
EDFDTLTLDNHFAAKFATGPLQHNVLLGIDYQHITGENFQQFNTGVSTNPLTSIPTLNLF
KPVYGGTMPSFDLTLLSSGYVNTYGKRTQVGVYLQDQIAIGRLQLIASGRFDWYDQTTRN
KRVAAGGNGAATFLSQNAFTARLGALYEFEFGLSPYFSFSESFEPQTGTRYVPGTSPLQT
EPFEPVTGRQYEAGLKFQPRGTNAIFTASVYDLRRRKVPVADPGAPANGLPSNSQIQIGE
VRVRGVELEGRGEVAPGLDVIVAGSYTDAIITQGTKATAATATVGAVPTTTGTRQLGTPE
WLASGFVSYDFGRNGGVAGPLGGLKLGAGVRHVGGSDGATQYKVVNGLAIFERFTTDSFT
LVDALLGYDLGKASSTLAGISLAVNAANLFDTRHVSACPFNNSCYFGAGRTVTGSLRFNW