Protein Info for Ga0059261_3588 in Sphingomonas koreensis DSMZ 15582

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF11638: DnaA_N" amino acids 5 to 64 (60 residues), 46.3 bits, see alignment E=4.1e-16 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 7 to 452 (446 residues), 470.8 bits, see alignment E=2.5e-145 PF00308: Bac_DnaA" amino acids 119 to 336 (218 residues), 246.9 bits, see alignment E=3.2e-77 PF08299: Bac_DnaA_C" amino acids 363 to 431 (69 residues), 100 bits, see alignment E=9e-33

Best Hits

Swiss-Prot: 50% identical to DNAA_SPHAL: Chromosomal replication initiator protein DnaA (dnaA) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 48% identity to mag:amb0636)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WH58 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Ga0059261_3588 chromosomal replication initiator protein DnaA (Sphingomonas koreensis DSMZ 15582)
MDQAKAWTRVRGNLRLSAGQRLFDQWLKPIVLIEGSDPETVRLGLPSPFMTNWVKGHYAE
RLLMEFRSQLPDVRTVSIETLARESRELAPEAESPAAAVPAAAPLAATPAASAERPRFDS
RFTFERFVVDTSNRVAFNAARALAEPGKPRFSPLYLHSSTGQGKTHLMHAIGHAFLEACP
DATAIYMPAERFMFEFVRAVREKDTFAFKARLRGVDLLMIDDLQFIAGKESTQEEFFHTV
DEFMREGKRLVIAADRSPLALEGIEARLASRLGAGLAADIKPAELGLRRAILGRKLEDMP
GAQVPAEVLDLLAARISSSVRELEGALNRLVAYAQLNDETVTIAFAESVLGEALRGSQRR
ITIDEIQKAVSSHFDVKQLDLVSQRRAVAIARPRQIAMYLAKRLTTRSLPEIGRKFGNRD
HSTVIHAVRRIEELRGTDSEIDTAVRNLMRQLEA