Protein Info for Ga0059261_3569 in Sphingomonas koreensis DSMZ 15582

Annotation: chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR02349: chaperone protein DnaJ" amino acids 6 to 348 (343 residues), 411.3 bits, see alignment E=2.1e-127 PF00226: DnaJ" amino acids 6 to 68 (63 residues), 89.8 bits, see alignment E=1.5e-29 PF01556: DnaJ_C" amino acids 118 to 332 (215 residues), 161.8 bits, see alignment E=1.9e-51 PF00684: DnaJ_CXXCXGXG" amino acids 145 to 205 (61 residues), 54.1 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 61% identical to DNAJ_ZYMMO: Chaperone protein DnaJ (dnaJ) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 73% identity to sjp:SJA_C1-09670)

MetaCyc: 53% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WH67 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Ga0059261_3569 chaperone protein DnaJ (Sphingomonas koreensis DSMZ 15582)
MTTQIDYYDLLEVERTADDATIKSAFRKLAIKFHPDKNGGCKDHEAKFKAINEAYDVLKD
PQKRAAYDRFGHAGPGGMGGGGQGPGFDAFSDIFESVFGEFMGGGRGGQQAQRRGADLRY
DMEISLEDAFHGKQTDITIDVSGICEPCGGTGASPGTMAKSCGTCRGHGKVRAQQGFFMV
ERTCPSCHGAGQTITDPCRNCRGEGRVDRTVTLAVNVPPGVDEGTRIRLSGQGEAGARGA
PPGDLYIFLHIARHPIFEREGTTLYARAPISFTTAALGGEIEIPGPDGELHQIRINPGTQ
SGREVRQRGAGMPVLQGRGRGDLVVKIEVEIPTKLSTEQRELLEQFRTLETGEECPASTG
FFDKLKKAVGGC