Protein Info for Ga0059261_3512 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): glutamate 5-kinase (EC 2.7.2.11)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01027.
Original annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 11 to 241 (231 residues), 131.2 bits, E=5.4e-42
• TIGR01027: glutamate 5-kinase
  • amino acids 11 to 365 (355 residues), 344.3 bits, E=4.3e-107
• PF01472: PUA
  • amino acids 278 to 344 (67 residues), 47.4 bits, E=1.5e-16

Best Hits

Swiss-Prot: 77% identical to PROB_SPHAL: Glutamate 5-kinase (proB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 77% identity to sal:Sala_2219)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See A0A1L6JE67 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Ga0059261_3512 glutamate 5-kinase (EC 2.7.2.11) (Sphingomonas koreensis DSMZ 15582)
MHLFPPASCPRLVVKIGSALLVDPEGAIRRDWLEGIAADIAARVRAGQQIAVVSSGAIAL
GARRLKLAKGGRASLEDAQAAAATGQIALSQVWAEVLAANGLTAAQMLVTLDDLEDRRRY
LNAAATLGRLLSLGVVPVINENDSVATAEIRFGDNDRLAARVAQAADASGVVLLSDIDGL
YDRNPALPGAVHIPVVERIDGRVEGMADRGSASGMGSGGMVSKIEAARIAASAGVSLAIA
NGRVDRPLSADARHTVFLPEKRTRARKAWLAGRLTAKGSIIVDAGAAQALTEGRSLLAIG
ATAIRGMFFRGDLVTIEGPNGPIARGLSEYDAPDAQAILGTRSDDQGEILGYAPRSTLVH
RNHMALL