Protein Info for Ga0059261_3506 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 4 to 360 (357 residues), 239.2 bits, see alignment E=2.7e-75 PF03739: LptF_LptG" amino acids 6 to 360 (355 residues), 208.1 bits, see alignment E=9.8e-66

Best Hits

KEGG orthology group: None (inferred from 69% identity to sal:Sala_2176)

Predicted SEED Role

"FIG00482480: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGY2 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Ga0059261_3506 Predicted permeases (Sphingomonas koreensis DSMZ 15582)
MTALDRYMARLIAVPLISTLLISAMLLVLDRMLKLFDFVATEGGPVSVVWRMLANLLPEY
LGLGIPIGLMLGILLAFRRLATSSELDVLRAVGMSYGRMLRVPFMFAIALAALNLAIVGF
IQPLARYNYEGLRFELRTGALGASIKVGEFTNLGDRMTLRIEDSRKEGTDLSGIFVSARA
PNGDVVSATAEKGQFLRTDDPDVIIFRLTKGTLIHQSPRFKVPRVLTFDAHDLPIDLPKF
EQFRQRGENKLELTLPQLAQIGSDPKSTETERAVSRSAFHFRVVEVATMLLLPFLALALG
VPPKRSTSALGVFLSIVMIVTYHKINEYAQGIGARGVIDPIIALWAPFLVFAGLVFWMYY
TIAYVPGGQPIGALEKFFAKTWKAIAKRLPGRRRKAAQA