Protein Info for Ga0059261_3502 in Sphingomonas koreensis DSMZ 15582

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 243 to 271 (29 residues), see Phobius details PF00487: FA_desaturase" amino acids 90 to 350 (261 residues), 83.4 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: None (inferred from 60% identity to sal:Sala_2178)

Predicted SEED Role

"Fatty acid desaturase, type 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WH08 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Ga0059261_3502 Fatty acid desaturase (Sphingomonas koreensis DSMZ 15582)
MPRNGHYLMPMADPMNTLTLDASGADAPAKGAKIRLSGVADDRTMLRAVADLTRDLQTPN
PLIYWGDFLGSAAVGYAALAGAILLPSTGWAIASGVLAVIALYRASLFIHEITHLKHSLL
PGFRVGWNLLLGIPMMLPSFMYEGIHTIHHSRTKYGTVEDPEYLPLALMKPWTLPVFLLV
SVLMPIGLLLRFGVLGPLSLLSPRLRKLVVGRYSGLQINPAYERRAPEGEFAKQWRWQEI
GASLWAIALIALVATGVIPLKAFAIFLAVISATAVLNQVRTLVAHLWENDGEPLTVTAQF
LDSVNVPGGFLPYIWAPVGLRFHALHHLLPSIPYHALAEAHRRISAELGTESIYEGANYP
TLRGLMGRLATSTMKQRAS