Protein Info for Ga0059261_3492 in Sphingomonas koreensis DSMZ 15582

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF04542: Sigma70_r2" amino acids 55 to 115 (61 residues), 47.4 bits, see alignment E=1.3e-16 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 55 to 195 (141 residues), 63.2 bits, see alignment E=1.1e-21 PF08281: Sigma70_r4_2" amino acids 143 to 194 (52 residues), 51.8 bits, see alignment E=5e-18

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 82% identity to sjp:SJA_C1-23330)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGZ9 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Ga0059261_3492 RNA polymerase sigma factor, sigma-70 family (Sphingomonas koreensis DSMZ 15582)
VRPAYLTEANPHLAGENERTRMTDSNQEGEDDAPPAEHVSLSDPEFKKQLALVIPHLRAF
GRSLSGSRDVADDLVQETLLKAWAARKRFQAGTNMRAWTFIILRNLYLSQMRRARFRGEW
DDLVADRLLAAPAAQDKHVDLADMQRALLHLPQPQREALILVGAGGFAYEEAAEICGVAV
GTIKSRVARGRVALETLMTDGSLPSRRDSESDGRTALDTIMDEVDQLSRDR