Protein Info for Ga0059261_3486 in Sphingomonas koreensis DSMZ 15582

Annotation: Twin arginine targeting (Tat) protein translocase TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 13 to 233 (221 residues), 220.3 bits, see alignment E=1.5e-69 PF00902: TatC" amino acids 15 to 228 (214 residues), 241 bits, see alignment E=5.8e-76

Best Hits

Swiss-Prot: 36% identical to TATC_AQUAE: Sec-independent protein translocase protein TatC (tatC) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 67% identity to swi:Swit_3928)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JE78 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Ga0059261_3486 Twin arginine targeting (Tat) protein translocase TatC (Sphingomonas koreensis DSMZ 15582)
VSDNELEGTEAPLLDHLIELRRRLLYCVLALVLAFAVCFYFVKPIYGFLVHPLAQAGQDK
LVFTSIMGGFFVELKVAFFAAVMVAFPIVAVQLWQFVAPGLYRKEKKALLPFLLATPALF
IAGASLAYWVTIPTALHFLLGYQGQLGGGVEQVALPDAEKYLGFVMQFLFAFGISFLLPV
LLMLLERAGIVTYEQLKGAWRYSVVAAFAIAAVLTPPDIGSQLLLAIPLCGLYFLSLVAI
WFTRRRREKESEKEAAAEAAAGE