Protein Info for Ga0059261_3483 in Sphingomonas koreensis DSMZ 15582

Annotation: segregation and condensation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00281: segregation and condensation protein B" amino acids 9 to 167 (159 residues), 109 bits, see alignment E=1.1e-35 PF04079: SMC_ScpB" amino acids 10 to 163 (154 residues), 166.5 bits, see alignment E=1.9e-53

Best Hits

Swiss-Prot: 43% identical to SCPB_DESRM: Segregation and condensation protein B (scpB) from Desulfotomaculum reducens (strain MI-1)

KEGG orthology group: K06024, segregation and condensation protein B (inferred from 76% identity to sch:Sphch_1441)

Predicted SEED Role

"Segregation and condensation protein B" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGV8 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Ga0059261_3483 segregation and condensation protein B (Sphingomonas koreensis DSMZ 15582)
MTRPDETMRAVEAVLFAAEEPLTVADIRAYVGEEVDLAAALAALADHYAGRGIELVERGG
RWHFQTAADLANFLRRDREDSRKLSRAGIETLAIIAYHEPVTRAEIEAIRGVQISKGTLD
VLMEAGWIRPAGRREVPGRPLTFATTPEFLTHFGLSSRRDLPGIDDLRAAGLLDPVDLAF
EAAHSGAETMVTADEED