Protein Info for Ga0059261_3463 in Sphingomonas koreensis DSMZ 15582

Annotation: UDP-N-acetylglucosamine-N-acetylmuramylpentapeptide N-acetylglucosamine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 5 to 358 (354 residues), 265.6 bits, see alignment E=3.1e-83 PF03033: Glyco_transf_28" amino acids 8 to 142 (135 residues), 109.6 bits, see alignment E=2e-35 PF13579: Glyco_trans_4_4" amino acids 20 to 129 (110 residues), 41.1 bits, see alignment E=3.5e-14 PF04101: Glyco_tran_28_C" amino acids 189 to 352 (164 residues), 140.1 bits, see alignment E=1.1e-44

Best Hits

Swiss-Prot: 64% identical to MURG_ZYMMO: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 70% identity to swi:Swit_3947)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGU1 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Ga0059261_3463 UDP-N-acetylglucosamine-N-acetylmuramylpentapeptide N-acetylglucosamine transferase (Sphingomonas koreensis DSMZ 15582)
MSSGKRYVLAAGGTGGHMVPAAALATELMRRGHKVALVSDERGVRFPDLFDGIETRVVPA
SRFSGGPIGWLRAANAMRKGRAQARALYREFRPSAVIAFGGYASLPALMAAFSAKVPAVI
HEQNAVLGRVNRLVAGKVAAIATSYADVERLKPAYEAKTHLVGNPVRQAVLDLRLRPYPP
LDEDSIFRVLVTGGSQGASVLSQVVPDGLALLPVHFRRRLQVTHQARVEDIDEVRRKYAD
HGIPAEIATYLPDLPERLAWAHLVIARAGASTIAELTAAGRPAILVPLPSATDDHQTANA
REISEAGGARTIPQRAFTASELAKQMQKLGLEPDALANAAACARSVGRPDAVRDLADLVE
SIDADWASAGQGHAKPITIEKAAYA