Protein Info for Ga0059261_3450 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 transmembrane" amino acids 26 to 64 (39 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details PF06127: Mpo1-like" amino acids 6 to 97 (92 residues), 111.9 bits, see alignment E=6.7e-37

Best Hits

KEGG orthology group: None (inferred from 62% identity to sal:Sala_2375)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JEA5 at UniProt or InterPro

Protein Sequence (108 amino acids)

>Ga0059261_3450 Predicted membrane protein (Sphingomonas koreensis DSMZ 15582)
MARAITRYADFWPYYLREHAKAQTRALHYAGTMLTFAALAAGIWLSSWWFLAIPLAGYGF
AWAAHFGVEKNRPATFTYPLWSLVSDYRMFFLWLGGRLGPHLQRAGVA