Protein Info for Ga0059261_3400 in Sphingomonas koreensis DSMZ 15582

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details PF17152: CHASE8" amino acids 43 to 139 (97 residues), 55.2 bits, see alignment E=7.5e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 241 to 400 (160 residues), 133.9 bits, see alignment E=2.3e-43 PF00990: GGDEF" amino acids 243 to 397 (155 residues), 147.7 bits, see alignment E=2.7e-47

Best Hits

KEGG orthology group: None (inferred from 44% identity to bam:Bamb_4436)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGP9 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Ga0059261_3400 diguanylate cyclase (GGDEF) domain (Sphingomonas koreensis DSMZ 15582)
VSGIAPLPTLRRVLARMHLRVTLFAVGLTGLTVLLAGFAAIGAYAGQNLHLIGRSAGYSA
APSIVFDDPVSAQQAIAPLLEPGVAGIALIKPDGTVLATVEREGQDDSLARWIADRLFFA
SPVDEPVIHLGSRIGTVRVRGEGSGVAAYIRDGVLGTLVCLVLTGLAAWLLSRRLRADIV
EPLNAIVDAAHGFRREETLDPKVPPASIREVEALRIDFNALIAELGDWRQHMRRENETLS
YKASHDALTGLPNRALFERRVGEMLAEARAGEASFVLLYADADSFKPINDRHGHAAGDAV
LIEVAARIRNCLRARDVAARLGGDEFAILLAAPSGADAAERVAGEIAARMAEPFRLPSGE
TVAMTLSLGAAIYPGDGQDLTTLINRADAAMYVAKGDLRARQQGV