Protein Info for Ga0059261_3398 in Sphingomonas koreensis DSMZ 15582

Annotation: Ribosomal protein L10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00466: Ribosomal_L10" amino acids 1 to 98 (98 residues), 91.9 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 71% identical to RL10_SPHWW: 50S ribosomal protein L10 (rplJ) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K02864, large subunit ribosomal protein L10 (inferred from 73% identity to npp:PP1Y_AT4027)

Predicted SEED Role

"LSU ribosomal protein L10p (P0)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JEQ8 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Ga0059261_3398 Ribosomal protein L10 (Sphingomonas koreensis DSMZ 15582)
MDRAQKTESVAELNRTFNEVAVVVVTRNLGMTVKQSTDLRNKAREAGANYKVAKNRLAKI
AIEGTDYSVLADLLVGPTALSTSTDPVAAAKVVAEFAKTNDKIEIVGGAMGSQLLDAEGV
KALASLPSLDELRGKIVGLLQAPASKLAAVTQAPAAQLARVFKAYAEKEAA