Protein Info for Ga0059261_3381 in Sphingomonas koreensis DSMZ 15582

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 12 (12 residues), see Phobius details transmembrane" amino acids 13 to 26 (14 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 328 (320 residues), 95.9 bits, see alignment E=1.2e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGL1 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Ga0059261_3381 Arabinose efflux permease (Sphingomonas koreensis DSMZ 15582)
VRLAAAAPLVFGAAVMVAAEFVVIGLIPPIIADLRLSPAQAGSLITVFALSSALLGPPLV
AAATRLPATFVLAGALLPFAANLLLLVVPDFPLMLLLRVLQGAALPLFMSRAGVQLGGGG
GNGRGIALLYVGVTLGGTLSPPAGSFMAGQFGWRLPVAAIGALALAGIIACLAGSFDAKP
DRTSAPWRLLARPTLRRHLLLSTLAFAAMFTGFSYAGLLLRHAGFVGDDVTLALLAFGAA
GLGGNWLAGKLASRALAGTAISALLTAMAALTLGTGPSVAGVVIVIWGAAHAAGFVFCQV
RVMDAAPEAPGFAGSLNISAANIGIAIGSLGGGKAIEAGGVTGASAAACVIALLAVGVAL
TWPNSNVIQTSS