Protein Info for Ga0059261_3314 in Sphingomonas koreensis DSMZ 15582

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07715: Plug" amino acids 61 to 158 (98 residues), 51.1 bits, see alignment E=1.7e-17 TIGR01783: TonB-dependent siderophore receptor" amino acids 63 to 720 (658 residues), 323.5 bits, see alignment E=1.6e-100 PF00593: TonB_dep_Rec" amino acids 335 to 690 (356 residues), 108.1 bits, see alignment E=1.1e-34

Best Hits

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WGE8 at UniProt or InterPro

Protein Sequence (720 amino acids)

>Ga0059261_3314 TonB-dependent siderophore receptor (Sphingomonas koreensis DSMZ 15582)
MVAHRIAVRGAAVAALAAALAAPAFAQETAAGEDVVITAQRDNQTQVSRNGSLGALGDKD
AMDTPFAVKSYNEALILNQQPLTLGAVLENDPSVRTTLGFGNMSEQFVVRGFNLFGEDIA
IDGLFGVTPRQLVSPELYDQIQILNGASAFLFGAAPGGSALGGTVNLTPKRAKDRDTNRL
TANWLSDKHFGGAFDFGRRFGEGKAFGFRLNGAYRSGDIAIDGEYRRSAVVGGSFDWRTD
NLRVSLDLAYQSVKAQHMRPMVQLNNKYGTVTAVPRPPRADLNYGQPWYNQTIRDVFGIF
KLEYDVTESLMFYASAGARDTAERGIYQGFQLLNSTTGAAFVTGSNIPRNDNNEAAQAGL
RFKGEGWGITHQLNMGYSHSRYVNRNAYEFGRFDDDAVNGTNLNNLYTPRAVAIPAFTAL
RAGNLADPNPANRTRLDSIFVSDTLGFADDVVQVTLGLRHQNIHFRTYNITTKAQNTEYS
ESTTTPVVGIVIRPSEKISLYANRIAALIQGPVAGAGTINVGQVFPPYQAVQYEIGGKVA
LGRFNASIAAFTTDRPQTLNEVTPGGTVFTLNGLQRNRGVEVSVDGEPLKGLRIIAGVSV
TDAKQRRTAGGLTDGRDAIGVPEYTANANVEWDVYGGLTLTGRVMQTGKQAVNLTNTLEL
PEWTRFDLGARYVVAIGDAPVTFRFNVDNVANKRYWASSLGGYLVQGMPRTFKASATIDF