Protein Info for Ga0059261_3262 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 26 to 26 (1 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF00892: EamA" amino acids 9 to 141 (133 residues), 33.2 bits, see alignment E=2.8e-12 amino acids 152 to 280 (129 residues), 42 bits, see alignment E=5.1e-15

Best Hits

KEGG orthology group: None (inferred from 52% identity to sch:Sphch_0062)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JES1 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Ga0059261_3262 Predicted permeases (Sphingomonas koreensis DSMZ 15582)
MSSDRIMLGLGLRLLAILMLSTMGALIKLVETHGAHLVEIMLFRQFFAIPFVLAWVMMGP
GLASLKTRHFGLHVSRSAVGLTGMVFNFGSVLLLPLAEATTFGFTVPIFATILGALVLKE
RTGWHRWGAVLAGFVGVLIVTQPGSGHIPLGGALVGLTAALFVAIVAIQLRQMGRTESPA
TTVFWFSTLSVPPLLIGYAFVAAPHDWQTFALLILIGFVGGAAQLALTASLRFAPVSAVV
PMDYSSLIWATLYGYLLFGVLPGSWTWVGAPIIIASGLYIVWRERQRGLRATPVATDEKA