Protein Info for Ga0059261_3246 in Sphingomonas koreensis DSMZ 15582

Annotation: Lysophospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF12146: Hydrolase_4" amino acids 38 to 293 (256 residues), 113.9 bits, see alignment E=1.2e-36 PF00561: Abhydrolase_1" amino acids 43 to 282 (240 residues), 41.2 bits, see alignment E=2.5e-14 PF12697: Abhydrolase_6" amino acids 73 to 273 (201 residues), 44.6 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: K01048, lysophospholipase [EC: 3.1.1.5] (inferred from 50% identity to nar:Saro_1082)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG90 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Ga0059261_3246 Lysophospholipase (Sphingomonas koreensis DSMZ 15582)
MASSPFDRRAIPAGAAIGVWHAEDGWPLRRFDWPAPGAPRGSILFQGGRGDVVEKYLETL
AHWQAQGWNIAWFDWRGQSGSGRIDGATSGHIRDFADYIADYRSFAREWQASTPGPHVVM
GHSMGGHLVLRALVERAIRPDAAVLVAPMLGLKSPLGLAAVGERFARLMGSLGNPARAAW
KANERPYTIESRQSLLTHDRDRYQDELWWQQANPANVTGPPSWTWLIEAFRSTRELRDSP
ALAAMNVPLLALVAEADGLVDAKAGLAMLAKLPDARVVRFGNESAHEILREIDSVRDRAI
SEIDGFLEAYAPRK