Protein Info for Ga0059261_3222 in Sphingomonas koreensis DSMZ 15582

Annotation: adenine phosphoribosyltransferase (EC 2.4.2.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 transmembrane" amino acids 61 to 79 (19 residues), see Phobius details TIGR01090: adenine phosphoribosyltransferase" amino acids 7 to 173 (167 residues), 191.5 bits, see alignment E=5.9e-61 PF00156: Pribosyltran" amino acids 35 to 152 (118 residues), 52.5 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 56% identical to APT_RHOPT: Adenine phosphoribosyltransferase (apt) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 62% identity to sch:Sphch_2678)

MetaCyc: 52% identical to adenine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JEX0 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Ga0059261_3222 adenine phosphoribosyltransferase (EC 2.4.2.7) (Sphingomonas koreensis DSMZ 15582)
MPADDLAALIRTIPDFPKPGIQFRDITTLLLDPAGLARAVEAIIDAVDGPVDLVAGIEAR
GFLFASPVALALGAGVLLVRKDGKLPGATIAEDYALEYGTDRIAIHADAFAPGARVLLID
DLIATGGTARAAVRLLRKAGAQVTQAAFVIDLPDLGGADALRAEGIHVTSLVAFDGH